"event" : "ProductMessageEdit", ] "context" : "", } }, Mit Verbindungen über VGA-Kabel können die Videos grundsätzlich nicht wiedergegeben werden. "disableKudosForAnonUser" : "false", })(LITHIUM.jQuery); "parameters" : { "context" : "envParam:feedbackData", "context" : "", } { } "forceSearchRequestParameterForBlurbBuilder" : "false", "messageViewOptions" : "1111110111111111111110111110100101001101" "context" : "", "action" : "rerender" var watching = false; "context" : "", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-896960 .lia-rating-control-passive', '#form_7'); "actions" : [ { { { "revokeMode" : "true", }, }, Für Links auf dieser Seite erhält CHIP ggf. { { { "buttonDialogCloseAlt" : "Schließen", "componentId" : "forums.widget.message-view", LITHIUM.StarRating('#any_8', false, 1, 'LITHIUM:starRating'); } { "revokeMode" : "true", "eventActions" : [ watching = false; ] "context" : "envParam:quiltName,message", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":896955,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "quiltName" : "ForumMessage", } count = 0; "actions" : [ "actions" : [ "context" : "", { } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "event" : "QuickReply", } "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" ] LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "componentId" : "kudos.widget.button", :motz: Bei Hotline hing ich beim ersten Versuch 30min in der Warteschleife um dann rausgeschmissen zu werden ohne einen Piep zu sagen. "actions" : [ "event" : "editProductMessage", { "event" : "ProductAnswer", "displayStyle" : "horizontal", "action" : "rerender" { } ], "message" : "896956", "context" : "envParam:quiltName,message", }); "truncateBody" : "true", { "action" : "pulsate" }, logmein: [76, 79, 71, 77, 69, 73, 78], }, "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" } { "event" : "MessagesWidgetMessageEdit", "defaultAriaLabel" : "", "action" : "rerender" "forceSearchRequestParameterForBlurbBuilder" : "false", } }, } "event" : "ProductAnswerComment", "context" : "", "actions" : [ } "action" : "rerender" { { }); "actions" : [ { { } { } }, "event" : "ProductAnswerComment", "event" : "MessagesWidgetCommentForm", ] { { { "actions" : [ { "event" : "expandMessage", "actions" : [ { "actions" : [ }(LITHIUM.jQuery)); { { }, "disallowZeroCount" : "false", { "action" : "pulsate" }, }, ] { }, { } { { { "event" : "MessagesWidgetCommentForm", "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ { "actions" : [ "parameters" : { ;(function($) { "actions" : [ "parameters" : { "action" : "rerender" "context" : "envParam:selectedMessage", "action" : "rerender" } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "useSimpleView" : "false", ] ] "event" : "QuickReply", } "context" : "envParam:quiltName,message,product,contextId,contextUrl", "actions" : [ "useSubjectIcons" : "true", "context" : "envParam:entity", "actions" : [ "context" : "", } { "disableLinks" : "false", LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); { { LITHIUM.Loader.runJsAttached(); { "actions" : [ Weder in HD noch in normaler Qualität. "actions" : [ "event" : "RevokeSolutionAction", "context" : "envParam:quiltName", "action" : "rerender" }, "context" : "", "context" : "", { ] LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); { { "parameters" : { "useCountToKudo" : "false", "parameters" : { }); "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", { "actions" : [ ], LITHIUM.Dialog({ "disallowZeroCount" : "false", "context" : "envParam:feedbackData", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_342dcca0912e63","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_342dcca0912e63_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/ArchivStoerungsmeldungenInternetTVTel/thread-id/21833&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"8Q3ZjINsxI9SFrRC-eE0w5cY4LAwXheLwIugSwV7s-g."}); "event" : "ProductAnswer", "event" : "ProductMessageEdit", ] }, }, "event" : "MessagesWidgetEditAction", ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_342dcca0912e63_1","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/ArchivStoerungsmeldungenInternetTVTel/thread-id/21833&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "event" : "removeThreadUserEmailSubscription", "actions" : [ lithstudio: [], "useSubjectIcons" : "true", "disallowZeroCount" : "false", "event" : "removeThreadUserEmailSubscription", "context" : "lia-deleted-state", ] } "context" : "envParam:entity", "action" : "rerender" } } }, "initiatorBinding" : true, { "event" : "ProductAnswerComment", "revokeMode" : "true", "eventActions" : [ }); ] ] expireDate.setDate(expireDate.getDate() + 365*10); ', 'ajax'); { }, "selector" : "#kudosButtonV2_5", "actions" : [ { { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, { "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); expireDate.setDate(expireDate.getDate() + 365*10); { "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, "actions" : [ }, } "action" : "addClassName" "event" : "MessagesWidgetEditCommentForm", { { "useSubjectIcons" : "true", "context" : "envParam:entity", "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivStoerungsmeldungenInternetTVTel/thread-id/21833","ajaxErrorEventName":"LITHIUM:ajaxError","token":"JqI7uaQZjeWnwNDqso_KEmAp4-oB6GBQUAo-ZE2T5_U. ], ] { "actions" : [ "action" : "rerender" ] } } { "actions" : [ "event" : "ProductMessageEdit", } { "event" : "MessagesWidgetMessageEdit", "event" : "AcceptSolutionAction", "action" : "rerender" ] "action" : "pulsate" } { "action" : "rerender" ] "actions" : [ } "messageViewOptions" : "1111110111111111111110111110100101001101" { { "actions" : [ }, ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ], }, "context" : "envParam:quiltName,message", LITHIUM.Dialog({ { LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ } ] "actions" : [ } } "action" : "rerender" "initiatorBinding" : true, }, } { "displayStyle" : "horizontal", { "dialogKey" : "dialogKey" "selector" : "#messageview", { "initiatorBinding" : true, { "actions" : [ $('#community-menu-toggle').click(function() { ] "actions" : [ ] "useCountToKudo" : "false", logmein: [76, 79, 71, 77, 69, 73, 78], "context" : "", "parameters" : { "context" : "", }, { ] }, "quiltName" : "ForumMessage", // Set start to true only if the first key in the sequence is pressed "disallowZeroCount" : "false", "event" : "QuickReply", "message" : "896955", "selector" : "#messageview_5", { { "; ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":896959,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. }, "componentId" : "forums.widget.message-view", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" "selector" : "#kudosButtonV2_6", } "useCountToKudo" : "false", "eventActions" : [ } ], ] "disableLabelLinks" : "false", } }, LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "message" : "896959", { }, "event" : "removeThreadUserEmailSubscription", "truncateBody" : "true", { }, } "quiltName" : "ForumMessage", }, } { LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "", "event" : "ProductMessageEdit", "context" : "", "actions" : [ } "event" : "MessagesWidgetMessageEdit", "action" : "rerender" ] "actions" : [ ] "selector" : "#messageview_8", "showCountOnly" : "false", "event" : "MessagesWidgetMessageEdit", ] "useSimpleView" : "false", "context" : "", return; } "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, "context" : "", "actions" : [ "actions" : [ "selector" : "#messageview_7", }, "event" : "expandMessage", "actions" : [ { ] } "action" : "rerender" "event" : "MessagesWidgetEditAction", "message" : "896955", }, "event" : "unapproveMessage", // just for convenience, you need a login anyways... "event" : "AcceptSolutionAction", "useSubjectIcons" : "true", }, "context" : "", })(LITHIUM.jQuery); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "disableLabelLinks" : "false", element.removeClass('active'); } "componentId" : "kudos.widget.button", LITHIUM.StarRating('#any_9', false, 1, 'LITHIUM:starRating'); count++; "context" : "envParam:entity", "event" : "QuickReply", "event" : "removeMessageUserEmailSubscription", "defaultAriaLabel" : "", "event" : "MessagesWidgetEditAnswerForm", LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating'); "disableKudosForAnonUser" : "false", "displaySubject" : "true", "event" : "removeThreadUserEmailSubscription", "eventActions" : [ ] LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'D7xi3zIUO6FJKKmbcSKpQpRMNrSyda01ZYv9Mh7-Xmk. ] { "action" : "addClassName" "event" : "MessagesWidgetCommentForm", LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); } "actions" : [ ] "event" : "MessagesWidgetEditCommentForm", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-896959 .lia-rating-control-passive', '#form_6'); $(document).keydown(function(e) { }); "displaySubject" : "true", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_8","menuItemsSelector":".lia-menu-dropdown-items"}}); { } } }, } { { } ] { "truncateBody" : "true", } }, "disallowZeroCount" : "false", ] }, { "actions" : [ "entity" : "896956", "actions" : [ ] ;(function($) { { } { LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }, LITHIUM.AjaxSupport.ComponentEvents.set({ "initiatorDataMatcher" : "data-lia-message-uid" "selector" : "#kudosButtonV2_4", { }, "context" : "envParam:feedbackData", ] "event" : "approveMessage", ] ;(function($) { { "event" : "RevokeSolutionAction", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", return; } "actions" : [ "event" : "RevokeSolutionAction", } "event" : "approveMessage", "context" : "", "event" : "ProductAnswer", ] }, ], ] "actions" : [ "event" : "markAsSpamWithoutRedirect", ;(function($) { LITHIUM.AjaxSupport.useTickets = false; "initiatorDataMatcher" : "data-lia-kudos-id" { "event" : "QuickReply", ], { "action" : "rerender" }, Trotz neuem LNB gehen die o. g. Sender nicht. { { }); "action" : "rerender" $('#node-menu li.active').children('ul').show(); "event" : "MessagesWidgetMessageEdit", "event" : "editProductMessage", "actions" : [ }, ] { var watching = false; "context" : "", "disableKudosForAnonUser" : "false", ] }, "event" : "kudoEntity", }); "event" : "MessagesWidgetAnswerForm", "event" : "unapproveMessage", { "action" : "rerender" { }, ], { "actions" : [ //$(window).scroll(function() { "selector" : "#messageview_6", "context" : "", }, }, "context" : "lia-deleted-state", }, "action" : "pulsate" { "revokeMode" : "true", ] LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating'); ] "event" : "MessagesWidgetEditAnswerForm", { "action" : "addClassName" "actions" : [ })(LITHIUM.jQuery); }, "action" : "rerender" var key = e.keyCode; }); ] } { "event" : "removeMessageUserEmailSubscription", "event" : "ProductAnswer", { document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); "includeRepliesModerationState" : "false", }, }, { "closeImageIconURL" : "https://forum.vodafone.de/skins/images/B010C48F44022184404C13FCC14A9ADC/responsive_peak/images/button_dialog_close.svg", ] } } ] "disableKudosForAnonUser" : "false", "context" : "", } "selector" : "#kudosButtonV2_0", { { "initiatorBinding" : true, ] { { { "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); { ] "context" : "", { var count = 0; }, { "initiatorDataMatcher" : "data-lia-kudos-id" { }, "quiltName" : "ForumMessage", "actions" : [ { } "action" : "rerender" { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "action" : "rerender" } LITHIUM.Dialog.options['1201851201'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { { "event" : "addMessageUserEmailSubscription", "context" : "", "action" : "rerender" } "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", Bist du sicher, dass du fortfahren möchtest? $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); LITHIUM.AjaxSupport.ComponentEvents.set({ "initiatorBinding" : true, { } }); { count = 0; ], "parameters" : { "context" : "", }, "actions" : [ "actions" : [ "actions" : [ }, // Oops. "context" : "", } ] "actions" : [ "action" : "addClassName" ] }, .attr('aria-expanded','true') "context" : "", "action" : "rerender" "action" : "rerender" "action" : "rerender" lithadmin: [] "context" : "", "action" : "rerender" "selector" : "#kudosButtonV2_6", "disableLinks" : "false", "event" : "ProductMessageEdit", "context" : "", } { var key = e.keyCode; "action" : "rerender" "disableLabelLinks" : "false", window.location.replace('/t5/user/userloginpage'); }, { "action" : "rerender" "action" : "rerender" } { LITHIUM.AjaxSupport.ComponentEvents.set({ }, }, }, @digifrust: ja, sowohl Arte HD als auch Pro Sieben (und Pro Sieben HD) kann ich empfangen ... Dann mach mal einen manuellen Sendersuchlauf ( Zusatzsender suchen auf dem Sagem) . "context" : "envParam:quiltName,message", "event" : "MessagesWidgetCommentForm", "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); "action" : "rerender" "event" : "MessagesWidgetCommentForm", { { { "event" : "MessagesWidgetMessageEdit", "message" : "896959", }, ] } Alle Infos über die Empfangsarten und Anbieter. "actions" : [ "actions" : [ ] } "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", "disableLabelLinks" : "false", { { { "action" : "rerender" }, "actions" : [ } { "action" : "pulsate" { ] "parameters" : { } "actions" : [ $('#vodafone-community-header .lia-search-input-wrapper').hide(); "event" : "ProductAnswer", } "action" : "rerender" })(LITHIUM.jQuery); "action" : "rerender" "linkDisabled" : "false" "action" : "rerender" { { { LITHIUM.AjaxSupport.ComponentEvents.set({ "linkDisabled" : "false" }, { LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); "action" : "pulsate" { "actions" : [ }, LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); ] { "initiatorBinding" : true, "useCountToKudo" : "false", ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "envParam:quiltName,product,contextId,contextUrl", }, ;(function($) { ] } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivStoerungsmeldungenInternetTVTel/thread-id/21833","ajaxErrorEventName":"LITHIUM:ajaxError","token":"DC85SvyzgU-mhu_R0q3f1pU_DzZG0B5M-QJ8tePWNZw. ] "disallowZeroCount" : "false", "action" : "rerender" "initiatorBinding" : true, }, { LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, 'T9zArvRa1bv0NqHz-QTEEF79Lbnup-znKRAObvNi5Tg. "event" : "QuickReply", }, "context" : "", "context" : "envParam:quiltName,expandedQuiltName", "event" : "addMessageUserEmailSubscription", "action" : "rerender" { { "parameters" : { "actions" : [ }, "action" : "rerender" "action" : "rerender" LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] "event" : "approveMessage", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_36","feedbackSelector":".InfoMessage"}); })(LITHIUM.jQuery); "buttonDialogCloseAlt" : "Schließen", "action" : "rerender" }, ] } }, ] ] } } "event" : "addMessageUserEmailSubscription", "context" : "envParam:selectedMessage", "action" : "rerender" { "action" : "rerender" }, } "actions" : [ { "action" : "rerender" "action" : "rerender" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_8","componentSelector":"#lineardisplaymessageviewwrapper_8","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":896961,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "action" : "rerender" "actions" : [ "disableLinks" : "false", "eventActions" : [ { "context" : "", ] "action" : "pulsate" ], { "actions" : [ ] ] "initiatorDataMatcher" : "data-lia-kudos-id" "kudosable" : "true", } "eventActions" : [ { "actions" : [ "event" : "addMessageUserEmailSubscription", { "useCountToKudo" : "false", "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); "displayStyle" : "horizontal", "action" : "rerender" $(document).ready(function(){ // console.log(key); { var handleOpen = function(event) { "}); "context" : "lia-deleted-state", "action" : "rerender" { "actions" : [ "actions" : [ }; "displayStyle" : "horizontal", LITHIUM.AjaxSupport.ComponentEvents.set({ }, ] { ] ] } } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetEditAction", "}); LITHIUM.AjaxSupport.ComponentEvents.set({ { "event" : "MessagesWidgetCommentForm", } { { "selector" : "#kudosButtonV2_8", ] "context" : "envParam:selectedMessage", window.onclick = function(event) { { "disableLinks" : "false", "actions" : [ var keycodes = { "parameters" : { ] { LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "message" : "896958", })(LITHIUM.jQuery); { "event" : "ProductMessageEdit", "actions" : [ } "disableLabelLinks" : "false", { ] "message" : "896959", "useSimpleView" : "false", "action" : "pulsate" { "action" : "pulsate" "initiatorDataMatcher" : "data-lia-kudos-id" LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", "disableKudosForAnonUser" : "false", ] { } } } "action" : "rerender" "closeEvent" : "LITHIUM:lightboxCloseEvent", Re: Wie kann ich andere Geräte von Netzwerk entfer... Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_342dcca0912e63_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/ArchivStoerungsmeldungenInternetTVTel/thread-id/21833&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "context" : "envParam:quiltName", ] "action" : "rerender" // console.log('watching: ' + key); "initiatorDataMatcher" : "data-lia-message-uid" "event" : "addThreadUserEmailSubscription", "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); "context" : "", ] "action" : "pulsate" "actions" : [ "action" : "rerender" "event" : "expandMessage", // console.log(key); "actions" : [ "context" : "", } "event" : "kudoEntity", "parameters" : { "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ], }); "showCountOnly" : "false", { "action" : "rerender" "context" : "", ] "context" : "envParam:quiltName,message,product,contextId,contextUrl",